PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_07368A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 239aa    MW: 25083.2 Da    PI: 6.245
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_07368AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.68e-155597246
                               SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                               g +T+eEd  +v + +qlG++ W++Ia+ +  gRt++++k++w++
  Oropetium_20150105_07368A 55 GGFTEEEDAVIVSLYTQLGSK-WSLIASQLE-GRTDNDIKNYWNT 97
                               569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.0E-113460IPR009057Homeodomain-like
SuperFamilySSF466895.85E-2234103IPR009057Homeodomain-like
PROSITE profilePS500904.0773548IPR017877Myb-like domain
PROSITE profilePS5129422.23949103IPR017930Myb domain
SMARTSM007172.5E-1153101IPR001005SANT/Myb domain
PfamPF002496.8E-125597IPR001005SANT/Myb domain
CDDcd001675.56E-105799No hitNo description
Gene3DG3DSA:1.10.10.601.5E-1961100IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MFNLSRCPAV AVDLDGCTRH VFFVVCSPRG AGLKRCGKSC RLRWLNYLRP DIRHGGFTEE  60
EDAVIVSLYT QLGSKWSLIA SQLEGRTDND IKNYWNTKLK KRLAAAAAVY APSPQPLARQ  120
PAQLAPAAAH SPASSLFPSL AIPTVKTETY TCDDFLAPAE FRDPLVASGG GCADAAGGGS  180
TPASAASSAS NWSTDNGVSE GFLLDFCAGS SSDLGTAAGQ LELPGGYYYP LDPSLSLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-183510337105MYB PROTO-ONCOGENE PROTEIN
1mse_C2e-183510337105C-Myb DNA-Binding Domain
1msf_C2e-183510337105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3764092e-83AK376409.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3123B18.
GenBankJF9519082e-83JF951908.1 Triticum aestivum clone TaMYB25 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968503.14e-87PREDICTED: transcription factor RAX2-like
TrEMBLK3XL564e-87K3XL56_SETIT; Uncharacterized protein
STRINGSi002629m1e-86(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.12e-40myb domain protein 36